Ccl20 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ccl20 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	C-C motif chemokine ligand 20
Database Link	NP_062106 Entrez Gene 29538 Rat UniProt ID P97884
Background	Ccl20 is a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Ccl20 may play a role in modulating inflammatory cell recruitment to the CNS and therefore contribute to tissue injury in ischemic stroke and autoimmune diseases.
Synonyms	CKb4; exodus-1; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Note	Immunogen sequence homology: Human: 100%; Rat: 94%; Pig: 88%; Horse: 88%; Mouse: 88%; Rabbit: 88%; Guinea pig: 88%; Dog: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.