GALNT13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GALNT13 antibody: synthetic peptide directed towards the N terminal of human GALNT13. Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	polypeptide N-acetylgalactosaminyltransferase 13
Database Link	NP_443149 Entrez Gene 114805 Human UniProt ID Q8IUC8
Background	The GALNT13 protein is a member ofThe UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins byThe initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.The GALNT13 protein is a member ofThe UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) byThe initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue. [supplied by OMIM]
Synonyms	GalNAc-T13
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, O-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.