USP8 Rabbit Polyclonal Antibody
CNY 5,200.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 127 kDa |
Gene Name | ubiquitin specific peptidase 8 |
Database Link | |
Background | USP8 is a hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. USP8 converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. USP8 catalytic activity is enhanced in the M phase. USP8 is involved in cell proliferation. USP8 is required to enter into S phase in response to serum stimulation. USP8 may regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. USP8 probably regulates the stability of STAM2 and RASGRF1. USP8 regulates endosomal ubiquitin dynamics, cargo sorting, membrane traffic at early endosomes, and maintenance of ESCRT-0 stability. The level of protein ubiquitination on endosomes is essential for maintaining the morphology of the organelle.USP8 deubiquitinates EPS15 and controles tyrosine kinase stability.USP8 removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK signaling. USP8 is involved in acrosome biogenesis through interaction with the spermatid ESCRT-0 complex and microtubules. |
Synonyms | HumORF8; SPG59; UBPY |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Endocytosis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |