AMPK beta 1 (PRKAB1) (NM_006253) Human Tagged ORF Clone

CAT#: RC203911

PRKAB1 (Myc-DDK-tagged)-Human protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1)

ORF Plasmid: DDK tGFP



  "NM_006253" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


PRKAB1 mouse monoclonal antibody,clone OTI8D5
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms AMPK; HAMPKb
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203911 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAATACCAGCAGTGAGCGCGCCGCGCTGGAGCGGCATGGTGGCCATAAGACGCCCCGGAGGGACA
GCTCGGGGGGCACCAAGGACGGGGACAGGCCCAAGATCCTGATGGACAGCCCCGAAGACGCCGACCTCTT
CCACTCCGAGGAAATCAAGGCACCAGAGAAGGAGGAATTCCTGGCCTGGCAGCATGATCTGGAAGTGAAT
GATAAAGCTCCCGCCCAGGCTCGGCCAACGGTGTTTCGATGGACGGGGGGCGGAAAGGAAGTTTACTTAT
CTGGGTCCTTCAACAACTGGAGTAAACTTCCCCTCACCAGAAGCCACAATAACTTTGTAGCCATCCTGGA
TCTGCCGGAAGGAGAGCATCAGTACAAGTTCTTTGTGGATGGTCAGTGGACGCACGACCCTTCCGAGCCC
ATAGTAACCAGCCAGCTTGGCACAGTTAACAACATCATTCAAGTGAAGAAAACTGACTTTGAAGTATTTG
ATGCTTTAATGGTGGATTCCCAAAAGTGCTCCGATGTGTCTGAGCTGTCCAGTTCTCCCCCAGGACCCTA
CCATCAGGAGCCCTACGTCTGCAAACCCGAAGAGCGCTTTCGGGCACCCCCTATTCTCCCCCCACATCTC
CTCCAGGTCATCCTGAACAAGGACACGGGGATTTCCTGTGATCCAGCTTTGCTTCCTGAGCCCAATCACG
TCATGCTGAACCACCTATACGCGCTGTCTATCAAGGATGGAGTGATGGTGCTCAGCGCAACCCACCGGTA
CAAGAAGAAGTACGTCACCACCTTGTTATACAAGCCCATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203911 protein sequence
Red=Cloning site Green=Tags(s)

MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN
DKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEP
IVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHL
LQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006253
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006253.5
RefSeq Size 2412 bp
RefSeq ORF 813 bp
Locus ID 5564
UniProt ID Q9Y478
Domains isoamylase_N, AMPKBI
Protein Families Druggable Genome
Protein Pathways Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway
MW 30.4 kDa
Gene Summary The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...