NEDD8 (NM_006156) Human Tagged ORF Clone
CAT#: RC210479
- TrueORF®
NEDD8 (Myc-DDK-tagged)-Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8)
ORF Plasmid: tGFP
"NM_006156" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | NEDD-8 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210479 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTAATTAAAGTGAAGACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGG AGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATCCCCCCACAACAGCAGAGGCTCATCTACAGTGG CAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGTCCTTCACCTGGTG TTGGCTCTGAGAGGAGGAGGTGGTCTTAGGCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210479 protein sequence
Red=Cloning site Green=Tags(s) MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV LALRGGGGLRQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006156 |
ORF Size | 243 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006156.3 |
RefSeq Size | 625 bp |
RefSeq ORF | 246 bp |
Locus ID | 4738 |
UniProt ID | Q15843 |
Protein Families | Druggable Genome |
MW | 9.1 kDa |
Gene Summary | Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.[UniProtKB/Swiss-Prot Function] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Effects of the NEDD8-activating enzyme inhibitor MLN4924 on lytic reactivation of Kaposi's sarcoma-associated herpesvirus
,Chang, PJ;Chen, LW;Chen, LY;Hung, CH;Shih, YJ;Wang, SS;,
J. Virol.
,PubMed ID 28701396
[NEDD8]
|
Autophagy Suppresses Interleukin-1? (IL-1?) Signaling by Activation of p62 Degradation via Lysosomal and Proteasomal Pathways *
,null,
The Journal of Biological Chemistry
,PubMed ID 22167182
[NEDD8]
|
Autophagy Suppresses Interleukin-1ß (IL-1ß) Signaling by Activation of p62 Degradation via Lysosomal and Proteasomal Pathways
,Jongdae Lee, Hye Ri Kim, Christine Quinley, Joanna Kim, Jose Gonzalez-Navajas, Ramnik Xavier, and Eyal Raz,
J. Biol. Chem., Feb 2012; 287: 4033 - 4040.
[Nedd8]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210479L1 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC210479L2 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), mGFP tagged |
CNY 5,890.00 |
|
RC210479L3 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC210479L4 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), mGFP tagged |
CNY 3,600.00 |
|
RG210479 | NEDD8 (tGFP-tagged) - Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) |
CNY 2,800.00 |
|
SC110960 | NEDD8 (untagged)-Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) |
CNY 1,200.00 |