FBXO44 (NM_183413) Human Tagged ORF Clone

CAT#: RC219237

FBXO44 (Myc-DDK-tagged)-Human F-box protein 44 (FBXO44), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_183413" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Goat Anti-FBXO44 Antibody
    • 100 ug

CNY 5,371.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms FBG3; FBX6A; FBX30; Fbx44; Fbxo6a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219237 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGGGAACATCAACGAGCTGCCCGAGAACATCCTGCTGGAGCTGTTCACGCACGTGCCCGCCC
GCCAGCTGCTGCTGAACTGCCGCCTGGTCTGCAGCCTCTGGCGGGACCTCATCGACCTCGTGACCCTCTG
GAAACGCAAGTGCCTGCGAGAGGGCTTCATCACTGAGGACTGGGACCAGCCCGTGGCCGACTGGAAGATC
TTCTACTTCTTACGGAGCCTGCACAGGAACCTCCTGCACAACCCGTGCGCTGAAGAGGGGTTCGAGTTCT
GGAGCCTGGATGTGAATGGAGGCGATGAGTGGAAGGTGGAGGATCTCTCTCGAGACCAGAGGAAGGAATT
CCCCAATGACCAGGTTCGCAGCCAGGCCAGATTGCGGGTCCAAGTACCAGCTGTGCGTTCAGCTCCTGTC
GTCCGCGCACGCGCCTCTGGGGACCTTCCAGCCAGACCCGGCGACCATCCAGCAGAAGAGCGATGCCAAG
TGGAGGGAGGTCTCCCACACATTCTCCAACTACCCGCCCGGCGTCCGCTACATCTGGTTTCAGCACGGCG
GCGTGGACACTCATTACTGGGCCGGCTGGTACGGCCCGAGGGTCACCAACAGCAGCATCACCATCGGGCC
CCCGCTGCCCTGACACCCCCTGAGCCCCCATCTGCTGAACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219237 protein sequence
Red=Cloning site Green=Tags(s)

MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI
FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPV
VRARASGDLPARPGDHPAEERCQVEGGLPHILQLPARRPLHLVSARRRGHSLLGRLVRPEGHQQQHHHRA
PAALTPPEPPSAEP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_183413
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_183413.2, NP_904320.1
RefSeq Size 2823 bp
RefSeq ORF 675 bp
Locus ID 93611
UniProt ID Q9H4M3
Protein Families Druggable Genome
MW 25.7 kDa
Gene Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Several alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Feb 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...