Cadherin like 23 (CDH23) (NM_001171936) Human Tagged ORF Clone

CAT#: RC229708

  • TrueORF®

CDH23 (Myc-DDK-tagged)-Human cadherin-related 23 (CDH23), transcript variant 9

ORF Plasmid: DDK tGFP



  "NM_001171936" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Anti-CDH23 Rabbit Polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CDHR23; PITA5; USH1D
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229708 representing NM_001171936
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGTCCTGGTTCCAGCAGGATCCTATGGTGGGAGCATGCACCACAGGCACCAGGGCCTCACACCCCA
AAGCCAACCCTGTGTGGCTGGATCCCTTCTGTCGGAACCTGGAGCTGGCCGCCCAGGCGGAGCATGAGGA
TGACCTACCGGAGAACCTGAGTGAGATCGCCGACCTGTGGAACAGCCCCACGCGCACCCATGGAACTTTT
GGGCGTGAGCCAGCAGCTGTCAAGCCTGATGATGACCGATACCTGCGGGCTGCCATCCAGGAGTATGACA
ACATTGCCAAGCTGGGCCAGATCATTCGTGAGGGGCCAATCAAGCTGATACAGACTGAGCTGGACGAGGA
GCCAGGAGACCACAGCCCAGGGCAGGGTAGCCTGCGCTTCCGCCACAAGCCACCAGTGGAGCTCAAGGGG
CCCGATGGGATCCATGTGGTGCACGGCAGCACGGGCACGCTGCTGGCCACCGACCTCAACAGCCTGCCCG
AGGAAGACCAGAAGGGCCTGGGCCGCTCGCTGGAGACGCTGACCGCTGCCGAGGCCACTGCCTTCGAGCG
CAACGCCCGCACAGAATCCGCCAAATCCACACCCCTGCACAAACTTCGCGACGTGATCATGGAGACCCCC
CTGGAGATCACAGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229708 representing NM_001171936
Red=Cloning site Green=Tags(s)

MRSWFQQDPMVGACTTGTRASHPKANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTF
GREPAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKLIQTELDEEPGDHSPGQGSLRFRHKPPVELKG
PDGIHVVHGSTGTLLATDLNSLPEEDQKGLGRSLETLTAAEATAFERNARTESAKSTPLHKLRDVIMETP
LEITEL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001171936
ORF Size 648 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001171936.1, NP_001165407.1
RefSeq ORF 651 bp
Locus ID 64072
UniProt ID Q9H251
Protein Families Transmembrane
MW 24.3 kDa
Gene Summary This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Upregulation of this gene may also be associated with breast cancer. Alternative splice variants encoding different isoforms have been described. [provided by RefSeq, May 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...