PLA2G5 (NM_000929) Human Tagged ORF Clone

CAT#: RG207789

  • TrueORF®

PLA2G5 (tGFP-tagged) - Human phospholipase A2, group V (PLA2G5)

ORF Plasmid: DDK tGFP



  "NM_000929" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 5,420.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-PLA2G5 Antibody
    • 50 ug

CNY 5,200.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms FRFB; GV-PLA2; hVPLA(2); PLA2-10
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG207789 representing NM_000929
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGGCCTCCTCCCACTGGCTTGGTTCCTGGCTTGTAGTGTGCCTGCTGTGCAAGGAGGCTTGCTGG
ACCTAAAATCAATGATCGAGAAGGTGACAGGGAAGAACGCCCTGACAAACTACGGCTTCTACGGCTGTTA
CTGCGGCTGGGGCGGCCGAGGAACCCCCAAGGATGGCACCGATTGGTGCTGTTGGGCGCATGACCACTGC
TATGGGCGGCTGGAGGAGAAGGGCTGCAACATTCGCACACAGTCCTACAAATACAGATTCGCGTGGGGCG
TGGTCACCTGCGAGCCCGGGCCCTTCTGCCATGTGAACCTCTGTGCCTGTGACCGGAAGCTCGTCTACTG
CCTCAAGAGAAACCTACGGAGCTACAACCCACAGTACCAATACTTTCCCAACATCCTCTGCTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG207789 representing NM_000929
Red=Cloning site Green=Tags(s)

MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHC
YGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000929
ORF Size 414 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000929.3
RefSeq Size 1911 bp
RefSeq ORF 417 bp
Locus ID 5322
UniProt ID P39877
Domains PA2c
Protein Families Druggable Genome, Secreted Protein
Protein Pathways alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway
Gene Summary This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholipids and free fatty acids including arachidonic acid. It preferentially hydrolyzes linoleoyl-containing phosphatidylcholine substrates. Secretion of this enzyme is thought to induce inflammatory responses in neighboring cells. Alternatively spliced transcript variants have been found, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...