TOLLIP (NM_019009) Human Mass Spec Standard
CAT#: PH300227
TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882)
View other "TOLLIP" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200227 |
Predicted MW | 30.3 kDa |
Protein Sequence |
>RC200227 protein sequence
Red=Cloning site Green=Tags(s) MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061882 |
RefSeq Size | 3665 |
RefSeq ORF | 822 |
Synonyms | IL-1RAcPIP |
Locus ID | 54472 |
Cytogenetics | 11p15.5 |
Summary | This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402724 | TOLLIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402724 | Transient overexpression lysate of toll interacting protein (TOLLIP) |
CNY 3,080.00 |
|
TP300227 | Recombinant protein of human toll interacting protein (TOLLIP), 20 µg |
CNY 2,900.00 |
|
TP720557 | Recombinant protein of human toll interacting protein (TOLLIP) |
CNY 3,140.00 |