MANBAL (NM_001003897) Human Mass Spec Standard
CAT#: PH300796
MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897)
View other "MANBAL" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200796 |
Predicted MW | 9.5 kDa |
Protein Sequence |
>RC200796 protein sequence
Red=Cloning site Green=Tags(s) MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV PSVNKRPKKETKKKR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001003897 |
RefSeq Size | 1268 |
RefSeq ORF | 255 |
Locus ID | 63905 |
Cytogenetics | 20q11.23 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411800 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424033 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411800 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1 |
CNY 3,080.00 |
|
LY424033 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 |
CNY 3,080.00 |
|
PH305099 | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) |
CNY 19,520.00 |
|
TP300796 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP305099 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1, 20 µg |
CNY 2,900.00 |