United States
Germany
Japan
United Kingdom
China
CLDND1 (NM_019895) Human Mass Spec Standard
CAT＃: PH301014
CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948)
View other "CLDND1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201014 |
| Predicted MW | 28.6 kDa |
| Protein Sequence |
>RC201014 protein sequence
Red=Cloning site Green=Tags(s) MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_063948 |
| RefSeq Size | 2244 |
| RefSeq ORF | 759 |
| Synonyms | C3orf4; GENX-3745; Z38 |
| Locus ID | 56650 |
| Cytogenetics | 3q11.2 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412679 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421715 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421717 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421724 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421725 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412679 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 2 |
CNY 3,080.00 |
|
| LY421715 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 1 |
CNY 3,080.00 |
|
| LY421717 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 3 |
CNY 3,080.00 |
|
| LY421724 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 6 |
CNY 3,080.00 |
|
| LY421725 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 7 |
CNY 3,080.00 |
|
| TP301014 | Recombinant protein of human claudin domain containing 1 (CLDND1), transcript variant 2, 20 µg |
CNY 2,900.00 |
