United States
Germany
Japan
United Kingdom
China
SF2 (SRSF1) (NM_006924) Human Mass Spec Standard
CAT＃: PH301636
SFRS1 MS Standard C13 and N15-labeled recombinant protein (NP_008855)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | SFRS1 MS Standard C13 and N15-labeled recombinant protein (NP_008855) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201636 |
| Predicted MW | 27.7 kDa |
| Protein Sequence |
>RC201636 protein sequence
Red=Cloning site Green=Tags(s) MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008855 |
| RefSeq Size | 5468 |
| RefSeq ORF | 744 |
| Synonyms | ASF; SF2; SF2p33; SFRS1; SRp30a |
| Locus ID | 6426 |
| Cytogenetics | 17q22 |
| Summary | This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 2014] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402060 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421492 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425877 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402060 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1 |
CNY 3,080.00 |
|
| LY421492 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 |
CNY 3,080.00 |
|
| LY425877 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 |
CNY 3,080.00 |
|
| TP301636 | Recombinant protein of human splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP761870 | Purified recombinant protein of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
