EPCAM (NM_002354) Human Mass Spec Standard
CAT#: PH301989
EPCAM MS Standard C13 and N15-labeled recombinant protein (NP_002345)
View other "EPCAM" proteins (16)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | EPCAM MS Standard C13 and N15-labeled recombinant protein (NP_002345) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201989 |
Predicted MW | 34.9 kDa |
Protein Sequence |
>RC201989 representing NM_002354
Red=Cloning site Green=Tags(s) MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002345 |
RefSeq Size | 1528 |
RefSeq ORF | 942 |
Synonyms | DIAR5; EGP-2; EGP40; EGP314; ESA; HNPCC8; KS1/4; KSA; M4S1; MIC18; MK-1; TACSTD1; TROP1 |
Locus ID | 4072 |
Cytogenetics | 2p21 |
Summary | This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008] |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400847 | EPCAM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400847 | Transient overexpression lysate of epithelial cell adhesion molecule (EPCAM) |
CNY 3,080.00 |
|
TP301989 | Recombinant protein of human epithelial cell adhesion molecule (EPCAM), 20 µg |
CNY 2,900.00 |
|
TP710374 | Purified recombinant protein of Human epithelial cell adhesion molecule (EPCAM), esidues 24-265aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720296 | Recombinant protein of human epithelial cell adhesion molecule (EPCAM) |
CNY 3,850.00 |
|
TP721349 | Human Trop1/EpCAM Protein (C-His) |
CNY 2,450.00 |
|
TP721350 | Human Trop1/EpCAM Protein (C-His-Avi) |
CNY 2,450.00 |
|
TP721351 | Biotinylated Human Trop1/EpCAM Protein (C-His-Avi) |
CNY 3,480.00 |
|
TP721352 | PE Conjugated Human Trop1/EpCAM Protein (C-His) |
CNY 3,480.00 |
|
TP721353 | APC Conjugated Human Trop1/EpCAM Protein (C-His) |
CNY 3,480.00 |
|
TP721354 | Human Trop1/EpCAM Protein (C-Fc) |
CNY 2,450.00 |
|
TP721355 | Human Trop1/EpCAM Protein (C-Fc-Avi) |
CNY 2,450.00 |
|
TP721356 | Biotinylated Human Trop1/EpCAM Protein (C-Fc-Avi) |
CNY 3,480.00 |
|
TP721357 | PE Conjugated Human Trop1/EpCAM Protein (C-Fc) |
CNY 3,480.00 |
|
TP721358 | APC Conjugated Human Trop1/EpCAM Protein (C-Fc) |
CNY 3,480.00 |
|
TP723976 | Human EPCAM Protein, His Tag |
CNY 4,925.00 |