CLIC3 (NM_004669) Human Mass Spec Standard
CAT#: PH302726
CLIC3 MS Standard C13 and N15-labeled recombinant protein (NP_004660)
View other "CLIC3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLIC3 MS Standard C13 and N15-labeled recombinant protein (NP_004660) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202726 |
Predicted MW | 26.6 kDa |
Protein Sequence |
>RC202726 protein sequence
Red=Cloning site Green=Tags(s) MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSD AKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDS YLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM QEKEFKYTCPHSAEILAAYRPAVHPR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004660 |
RefSeq Size | 813 |
RefSeq ORF | 708 |
Locus ID | 9022 |
Cytogenetics | 9q34.3 |
Summary | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417836 | CLIC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417836 | Transient overexpression lysate of chloride intracellular channel 3 (CLIC3) |
CNY 3,080.00 |
|
TP302726 | Recombinant protein of human chloride intracellular channel 3 (CLIC3), 20 µg |
CNY 2,900.00 |
|
TP720996 | Purified recombinant protein of Human chloride intracellular channel 3 (CLIC3) |
CNY 5,460.00 |