Ferritin Light Chain (FTL) (NM_000146) Human Mass Spec Standard
CAT#: PH303296
FTL MS Standard C13 and N15-labeled recombinant protein (NP_000137)
View other "Ferritin Light Chain" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FTL MS Standard C13 and N15-labeled recombinant protein (NP_000137) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203296 |
Predicted MW | 20 kDa |
Protein Sequence |
>RC203296 protein sequence
Red=Cloning site Green=Tags(s) MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000137 |
RefSeq Size | 889 |
RefSeq ORF | 525 |
Synonyms | LFTD; NBIA3 |
Locus ID | 2512 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400051 | FTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400051 | Transient overexpression lysate of ferritin, light polypeptide (FTL) |
CNY 3,080.00 |
|
TP303296 | Recombinant protein of human ferritin, light polypeptide (FTL), 20 µg |
CNY 2,900.00 |
|
TP721181 | Purified recombinant protein of Human ferritin, light polypeptide (FTL) |
CNY 4,550.00 |
其它Ferritin Light Chain产品