United States
Germany
Japan
United Kingdom
China
RAB37 (NM_001006638) Human Mass Spec Standard
CAT＃: PH304510
RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_001006639)
View other "RAB37" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_001006639) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204510 |
| Predicted MW | 24.8 kDa |
| Protein Sequence |
>RC204510 protein sequence
Red=Cloning site Green=Tags(s) MTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNK VVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIML LGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYV ESQKKRSSCCSFM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001006639 |
| RefSeq Size | 2698 |
| RefSeq ORF | 669 |
| Locus ID | 326624 |
| Cytogenetics | 17q25.1 |
| Summary | Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.[supplied by OMIM, Apr 2006] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406250 | RAB37 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423534 | RAB37 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431148 | RAB37 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406250 | Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 3 |
CNY 3,080.00 |
|
| LY423534 | Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 2 |
CNY 3,080.00 |
|
| LY431148 | Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 5 |
CNY 3,080.00 |
|
| PH306946 | RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_783865) |
CNY 19,520.00 |
|
| TP304510 | Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP306946 | Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP328120 | Purified recombinant protein of Homo sapiens RAB37, member RAS oncogene family (RAB37), transcript variant 5, 20 µg |
CNY 2,900.00 |
