CLIC5 (NM_016929) Human Mass Spec Standard
CAT#: PH305906
CLIC5 MS Standard C13 and N15-labeled recombinant protein (NP_058625)
View other "CLIC5" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLIC5 MS Standard C13 and N15-labeled recombinant protein (NP_058625) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205906 |
Predicted MW | 28.2 kDa |
Protein Sequence |
>RC205906 protein sequence
Red=Cloning site Green=Tags(s) MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGT HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERG LTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE MTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_058625 |
RefSeq Size | 5752 |
RefSeq ORF | 753 |
Synonyms | DFNB102; DFNB103; MST130; MSTP130 |
Locus ID | 53405 |
Cytogenetics | 6p21.1 |
Summary | This gene encodes a member of the chloride intracellular channel (CLIC) family of chloride ion channels. The encoded protein associates with actin-based cytoskeletal structures and may play a role in multiple processes including hair cell stereocilia formation, myoblast proliferation and glomerular podocyte and endothelial cell maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402589 | CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426442 | CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402589 | Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 2 |
CNY 3,080.00 |
|
LY426442 | Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 1 |
CNY 3,080.00 |
|
TP305906 | Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720188 | Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 1 |
CNY 5,460.00 |