Profilin 2 (PFN2) (NM_053024) Human Mass Spec Standard
CAT#: PH307366
PFN2 MS Standard C13 and N15-labeled recombinant protein (NP_444252)
View other "Profilin 2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PFN2 MS Standard C13 and N15-labeled recombinant protein (NP_444252) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207366 |
Predicted MW | 15 kDa |
Protein Sequence |
>RC207366 protein sequence
Red=Cloning site Green=Tags(s) MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_444252 |
RefSeq Size | 2117 |
RefSeq ORF | 420 |
Synonyms | D3S1319E; PFL |
Locus ID | 5217 |
Cytogenetics | 3q25.1 |
Summary | The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400933 | PFN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409326 | PFN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400933 | Transient overexpression lysate of profilin 2 (PFN2), transcript variant 2 |
CNY 3,080.00 |
|
LY409326 | Transient overexpression lysate of profilin 2 (PFN2), transcript variant 1 |
CNY 3,080.00 |
|
TP307366 | Recombinant protein of human profilin 2 (PFN2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP721010 | Purified recombinant protein of Human profilin 2 (PFN2), transcript variant 1 |
CNY 4,550.00 |
其它Profilin 2产品