GNMT (NM_018960) Human Mass Spec Standard
CAT#: PH307497
GNMT MS Standard C13 and N15-labeled recombinant protein (NP_061833)
View other "GNMT" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GNMT MS Standard C13 and N15-labeled recombinant protein (NP_061833) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207497 |
Predicted MW | 32.7 kDa |
Protein Sequence |
>RC207497 protein sequence
Red=Cloning site Green=Tags(s) MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV DSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLG NSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVL IVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQ TYIPCYFIHVLKRTD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061833 |
RefSeq Size | 1091 |
RefSeq ORF | 885 |
Synonyms | HEL-S-182mP |
Locus ID | 27232 |
Cytogenetics | 6p21.1 |
Summary | The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Glycine, serine and threonine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412848 | GNMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412848 | Transient overexpression lysate of glycine N-methyltransferase (GNMT) |
CNY 3,080.00 |
|
TP307497 | Recombinant protein of human glycine N-methyltransferase (GNMT), 20 µg |
CNY 2,900.00 |
|
TP720534 | Recombinant protein of human glycine N-methyltransferase (GNMT) |
CNY 5,460.00 |