AGR3 (NM_176813) Human Mass Spec Standard
CAT#: PH308897
AGR3 MS Standard C13 and N15-labeled recombinant protein (NP_789783)
View other "AGR3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | AGR3 MS Standard C13 and N15-labeled recombinant protein (NP_789783) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208897 |
Predicted MW | 19.2 kDa |
Protein Sequence |
>RC208897 protein sequence
Red=Cloning site Green=Tags(s) MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLED CQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRL YTYEPRDLPLLIENMKKALRLIQSEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_789783 |
RefSeq Size | 763 |
RefSeq ORF | 498 |
Synonyms | AG-3; AG3; BCMP11; hAG-3; HAG3; PDIA18 |
Locus ID | 155465 |
Cytogenetics | 7p21.1 |
Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This gene is expressed in ciliated airway epithelial cells and, in mouse, plays a role in ciliary beat frequency in multiciliated cells. This gene is also over-expressed in breast, ovarian, and prostrate cancers. [provided by RefSeq, Dec 2016] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403593 | AGR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403593 | Transient overexpression lysate of anterior gradient homolog 3 (Xenopus laevis) (AGR3) |
CNY 3,080.00 |
|
TP308897 | Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3), 20 µg |
CNY 2,900.00 |
|
TP720456 | Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3) |
CNY 3,140.00 |