Catalase (CAT) (NM_001752) Human Mass Spec Standard
CAT#: PH310763
CAT MS Standard C13 and N15-labeled recombinant protein (NP_001743)
View other "Catalase" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CAT MS Standard C13 and N15-labeled recombinant protein (NP_001743) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210763 |
Predicted MW | 59.8 kDa |
Protein Sequence |
>RC210763 protein sequence
Red=Cloning site Green=Tags(s) MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIP ERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTED GNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHR HMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFY IQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKM LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALE HSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYG SHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001743 |
RefSeq Size | 2300 |
RefSeq ORF | 1581 |
Locus ID | 847 |
Cytogenetics | 11p13 |
Summary | This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Metabolic pathways, Methane metabolism, Tryptophan metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Anti-apoptotic proteins and catalase-dependent apoptosis resistance in nickel chloride-transformed human lung epithelial cells
,null,
International Journal of Oncology
,PubMed ID 23828460
[CAT]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419766 | CAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419766 | Transient overexpression lysate of catalase (CAT) |
CNY 3,080.00 |
|
TP310763 | Recombinant protein of human catalase (CAT), 20 µg |
CNY 2,900.00 |
|
TP720852 | Purified recombinant protein of Human catalase (CAT) |
CNY 5,460.00 |
其它Catalase产品