CKMT1B (NM_020990) Human Mass Spec Standard
CAT#: PH312558
CKMT1B MS Standard C13 and N15-labeled recombinant protein (NP_066270)
View other "CKMT1B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CKMT1B MS Standard C13 and N15-labeled recombinant protein (NP_066270) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212558 |
Predicted MW | 47 kDa |
Protein Sequence |
>RC212558 protein sequence
Red=Cloning site Green=Tags(s) MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPA VYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKH TTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLS EMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMK RVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRL QKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066270 |
RefSeq Size | 1779 |
RefSeq ORF | 1251 |
Synonyms | CKMT; CKMT1; UMTCK |
Locus ID | 1159 |
Cytogenetics | 15q15.3 |
Summary | Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412155 | CKMT1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY412155 | Transient overexpression lysate of creatine kinase, mitochondrial 1B (CKMT1B), nuclear gene encoding mitochondrial protein |
CNY 4,840.00 |
|
TP312558 | Recombinant protein of human creatine kinase, mitochondrial 1B (CKMT1B), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |