H2BC7 (NM_003522) Human Mass Spec Standard

Specifications

Product Data
Description	HIST1H2BF MS Standard C13 and N15-labeled recombinant protein (NP_003513)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC214442
Predicted MW	13.9 kDa
Protein Sequence	Sequence Link (showhide) >RC214442 protein sequence Red=Cloning site Green=Tags(s) MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_003513
RefSeq Size	430
RefSeq ORF	378
Synonyms	H2B/g; H2BC4; H2BC6; H2BC8; H2BC10; H2BFG; HIST1H2BF
Locus ID	8343
Cytogenetics	6p22.2
Summary	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. The protein has antibacterial and antifungal antimicrobial activity. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015]
Protein Pathways	Systemic lupus erythematosus

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.