GOSR1 (NM_001007024) Human Mass Spec Standard
CAT#: PH314955
GOSR1 MS Standard C13 and N15-labeled recombinant protein (NP_001007025)
View other "GOSR1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | GOSR1 MS Standard C13 and N15-labeled recombinant protein (NP_001007025) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214955 |
Predicted MW | 28.61 kDa |
Protein Sequence |
>RC214955 representing NM_001007024
Red=Cloning site Green=Tags(s) MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001007025 |
RefSeq Size | 5246 |
RefSeq ORF | 750 |
Synonyms | GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28 |
Locus ID | 9527 |
Cytogenetics | 17q11.2 |
Summary | This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423566 | GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423567 | GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423566 | Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3 |
CNY 3,080.00 |
|
LY423567 | Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2 |
CNY 3,080.00 |
|
TP314955 | Recombinant protein of human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP760954 | Purified recombinant protein of Human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |