HYAL1 (NM_007312) Human Mass Spec Standard
CAT#: PH315525
HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_009296)
View other "HYAL1" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_009296) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215525 |
Predicted MW | 48.2 kDa |
Protein Sequence |
>RC215525 representing NM_007312
Red=Cloning site Green=Tags(s) MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPD MTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFN WDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNY DFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPN LPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILN VTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC YPGWQAPWCERKSMW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009296 |
RefSeq Size | 2518 |
RefSeq ORF | 1305 |
Synonyms | HYAL-1; LUCA1; MGC45987; NAT6 |
Locus ID | 3373 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402131 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407102 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407103 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409678 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402131 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1 |
CNY 3,080.00 |
|
LY407102 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 8 |
CNY 4,840.00 |
|
LY407103 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 2 |
CNY 3,080.00 |
|
LY409678 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7 |
CNY 4,840.00 |
|
PH316129 | HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_149349) |
CNY 19,520.00 |
|
TP315525 | Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP316129 | Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
TP721049 | Purified recombinant protein of Human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 5 |
CNY 4,550.00 |