Endonuclease V (ENDOV) (NM_173627) Human Mass Spec Standard
CAT#: PH315740
FLJ35220 MS Standard C13 and N15-labeled recombinant protein (NP_775898)
View other "Endonuclease V" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
CNY 3,080.00
Specifications
Product Data | |
Description | FLJ35220 MS Standard C13 and N15-labeled recombinant protein (NP_775898) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215740 |
Predicted MW | 30.6 kDa |
Protein Sequence |
>RC215740 representing NM_173627
Red=Cloning site Green=Tags(s) MALEAAGGPPEETLSLWKREQARLKAHVVDRDTEAWQRDPAFSGLQRVGGVDVSFVKGDSVRACASLVVL SFPELEVVYEESRMVSLTAPYVSGFLAFREVPFLLELVQQLREKEPGLMPQVLLVDGNGVLHHRGFGVAC HLGVLTDLPCVGVAKKLLQVDGLENNALHKEKIRLLQTRGDSFPLLGDSGTVLGMALRSHDRSTRPLYIS VGHRMSLEAAVRLTCCCCRFRIPEPVRQADICSREHIRKSLGLPGPPTPRSPKAQRPVACPKGDSGESSA LC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_775898 |
RefSeq Size | 2858 |
RefSeq ORF | 846 |
Locus ID | 284131 |
Cytogenetics | 17q25.3 |
Summary | Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Has strong preference for single-stranded RNAs (ssRNAs) toward double-stranded RNAs (dsRNAs). Cleaves mRNAs and tRNAs containing inosine. Also able to cleave structure-specific dsRNA substrates containing the specific sites 5'-IIUI-3' and 5'-UIUU-3'. Inosine is present in a number of RNAs following editing; the function of inosine-specific endoribonuclease is still unclear: it could either play a regulatory role in edited RNAs, or be involved in antiviral response by removing the hyperedited long viral dsRNA genome that has undergone A-to-I editing. Binds branched DNA structures.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Proteotoxic stress targeted therapy (PSTT): induction of protein misfolding enhances the antitumor effect of the proteasome inhibitor bortezomib
,null,
Oncotarget
,PubMed ID 21444945
[ENDOV]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406516 | ENDOV HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431196 | ENDOV HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406516 | Transient overexpression lysate of hypothetical protein FLJ35220 (FLJ35220), transcript variant 1 |
CNY 3,080.00 |
|
LY431196 | Transient overexpression lysate of endonuclease V (ENDOV), transcript variant 2 |
CNY 3,080.00 |
|
TP315740 | Recombinant protein of human hypothetical protein FLJ35220 (FLJ35220), 20 µg |
CNY 2,900.00 |
其它Endonuclease V产品