Prostaglandin D Synthase (PTGDS) (NM_000954) Human Mass Spec Standard
CAT#: PH316795
PTGDS MS Standard C13 and N15-labeled recombinant protein (NP_000945)
View other "Prostaglandin D Synthase" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PTGDS MS Standard C13 and N15-labeled recombinant protein (NP_000945) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216795 |
Predicted MW | 20.8 kDa |
Protein Sequence |
>RC216795 representing NM_000954
Red=Cloning site Green=Tags(s) MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000945 |
RefSeq Size | 837 |
RefSeq ORF | 570 |
Synonyms | L-PGDS; LPGDS; PDS; PGD2; PGDS; PGDS2 |
Locus ID | 5730 |
Cytogenetics | 9q34.3 |
Summary | The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008] |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400343 | PTGDS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400343 | Transient overexpression lysate of prostaglandin D2 synthase 21kDa (brain) (PTGDS) |
CNY 3,080.00 |
|
TP316795 | Recombinant protein of human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 20 µg |
CNY 2,900.00 |
|
TP720757 | Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS) |
CNY 4,550.00 |
其它Prostaglandin D Synthase产品