UCK (UCK1) (NM_031432) Human Mass Spec Standard
CAT#: PH320876
UCK1 MS Standard C13 and N15-labeled recombinant protein (NP_113620)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | UCK1 MS Standard C13 and N15-labeled recombinant protein (NP_113620) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220876 |
Predicted MW | 31.3 kDa |
Protein Sequence |
>RC220876 representing NM_031432
Red=Cloning site Green=Tags(s) MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV LTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGI LVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVII PRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRPH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_113620 |
RefSeq Size | 2160 |
RefSeq ORF | 831 |
Synonyms | URK1 |
Locus ID | 83549 |
Cytogenetics | 9q34.13 |
Summary | This gene encodes a uridine-cytidine kinase that catalyzes the phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP) but not the phosphorylation of deoxyribonucleosides or purine ribonucleosides. This enzyme can also phosphorylate uridine and cytidine analogs and uses both ATP and GTP as a phosphate donor. Alternative splicing results in multiple splice variants encoding distinct isoforms. [provided by RefSeq, May 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403114 | UCK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427742 | UCK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403114 | Transient overexpression lysate of uridine-cytidine kinase 1 (UCK1), transcript variant 1 |
CNY 3,080.00 |
|
LY427742 | Transient overexpression lysate of uridine-cytidine kinase 1 (UCK1), transcript variant 2 |
CNY 3,080.00 |
|
TP320876 | Recombinant protein of human uridine-cytidine kinase 1 (UCK1), transcript variant 1, 20 µg |
CNY 2,900.00 |