C4BPB (NM_000716) Human Mass Spec Standard
CAT#: PH323685
C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_000707)
View other "C4BPB" proteins (15)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_000707) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223685 |
Predicted MW | 28.29 kDa |
Protein Sequence |
>RC223685 representing NM_000716
Red=Cloning site Green=Tags(s) MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000707 |
RefSeq Size | 1131 |
RefSeq ORF | 968 |
Synonyms | C4BP |
Locus ID | 725 |
Cytogenetics | 1q32.1 |
Summary | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422638 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422639 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422641 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424545 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422638 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 2 |
CNY 3,080.00 |
|
LY422639 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 3 |
CNY 3,080.00 |
|
LY422641 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 5 |
CNY 3,080.00 |
|
LY424545 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 1 |
CNY 3,080.00 |
|
PH302799 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017365) |
CNY 14,250.00 |
|
PH319158 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017364) |
CNY 14,250.00 |
|
PH319216 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017367) |
CNY 14,250.00 |
|
TP302799 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP319158 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP319216 | Purified recombinant protein of Homo sapiens complement component 4 binding protein, beta (C4BPB), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP323685 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 1, 20 µg |
CNY 2,900.00 |