United States
Germany
Japan
United Kingdom
China
SIGIRR (NM_001135054) Human Mass Spec Standard
CAT＃: PH325643
SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128526)
View other "SIGIRR" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128526) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225643 |
| Predicted MW | 45.7 kDa |
| Protein Sequence |
>RC225643 protein sequence
Red=Cloning site Green=Tags(s) MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWV KANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYV KCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEP SADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVRYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDP DPEGDLGVRGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001128526 |
| RefSeq Size | 1761 |
| RefSeq ORF | 1230 |
| Synonyms | IL-1R8; TIR8 |
| Locus ID | 59307 |
| Cytogenetics | 11p15.5 |
| Summary | Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402876 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427540 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427541 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402876 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3 |
CNY 3,080.00 |
|
| LY427540 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2 |
CNY 3,080.00 |
|
| LY427541 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1 |
CNY 3,080.00 |
|
| PH301356 | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_068577) |
CNY 14,250.00 |
|
| PH325642 | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128525) |
CNY 19,520.00 |
|
| TP301356 | Purified recombinant protein of Homo sapiens single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP325642 | Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP325643 | Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP762571 | Purified recombinant protein of Human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 50ug |
CNY 2,480.00 |
