alpha smooth muscle Actin (ACTA2) (NM_001141945) Human Mass Spec Standard
CAT#: PH327802
ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417)
View other "alpha smooth muscle Actin" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227802 |
Predicted MW | 42 kDa |
Protein Sequence |
>RC227802 protein sequence
Red=Cloning site Green=Tags(s) MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001135417 |
RefSeq Size | 1798 |
RefSeq ORF | 1131 |
Synonyms | ACTSA |
Locus ID | 59 |
Cytogenetics | 10q23.31 |
Summary | This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome. [provided by RefSeq, Sep 2017] |
Protein Pathways | Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400608 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427983 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400608 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 2 |
CNY 3,080.00 |
|
LY427983 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1 |
CNY 3,080.00 |
|
TP327802 | Recombinant protein of human actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它alpha smooth muscle Actin产品