Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Recombinant Protein
CAT#: TP301605
Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), 20 µg
View other "Proteasome 20S beta 6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201605 protein sequence
Red=Cloning site Green=Tags(s) MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTP IHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQ EGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRL AAIAESGVERQVLLGDQIPKFAVATLPPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002789 |
Locus ID | 5694 |
UniProt ID | P28072 |
Refseq Size | 869 |
Cytogenetics | 17p13.2 |
Refseq ORF | 717 |
Synonyms | DELTA; LMPY; Y |
Summary | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. The encoded protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419101 | PSMB6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419101 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6) |
CNY 3,080.00 |
|
PH301605 | PSMB6 MS Standard C13 and N15-labeled recombinant protein (NP_002789) |
CNY 19,520.00 |
其它Proteasome 20S beta 6产品