SULT4A1 (NM_014351) Human Recombinant Protein
CAT#: TP306314
Recombinant protein of human sulfotransferase family 4A, member 1 (SULT4A1), 20 µg
View other "SULT4A1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206314 protein sequence
Red=Cloning site Green=Tags(s) MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPPGTSLLQEVVYLVSQG ADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVS YYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLA RFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFD FYL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055166 |
Locus ID | 25830 |
UniProt ID | Q9BR01 |
Refseq Size | 2465 |
Cytogenetics | 22q13.31 |
Refseq ORF | 849 |
Synonyms | BR-STL-1; BRSTL1; DJ388M5.3; hBR-STL-1; NST; SULTX3 |
Summary | This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402319 | SULT4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402319 | Transient overexpression lysate of sulfotransferase family 4A, member 1 (SULT4A1) |
CNY 3,080.00 |
|
PH306314 | SULT4A1 MS Standard C13 and N15-labeled recombinant protein (NP_055166) |
CNY 19,520.00 |
|
TP720928 | Purified recombinant protein of Human sulfotransferase family 4A, member 1 (SULT4A1) |
CNY 5,460.00 |
其它SULT4A1产品