Growth Hormone (GH1) (NM_022559) Human Recombinant Protein
CAT#: TP309608
Recombinant protein of human growth hormone 1 (GH1), transcript variant 2, 20 µg
View other "Growth Hormone" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209608 protein sequence
Red=Cloning site Green=Tags(s) MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQTSLCFSESIP TPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLE DGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_072053 |
Locus ID | 2688 |
UniProt ID | P01241 |
Refseq Size | 815 |
Cytogenetics | 17q23.3 |
Refseq ORF | 606 |
Synonyms | GH; GH-N; GHB5; GHN; hGH-N; IGHD1A; IGHD1B; IGHD2 |
Summary | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411627 | GH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424673 | GH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411627 | Transient overexpression lysate of growth hormone 1 (GH1), transcript variant 2 |
CNY 3,080.00 |
|
LY424673 | Transient overexpression lysate of growth hormone 1 (GH1), transcript variant 1 |
CNY 3,080.00 |
|
PH309608 | GH1 MS Standard C13 and N15-labeled recombinant protein (NP_072053) |
CNY 19,520.00 |
|
PH315644 | GH1 MS Standard C13 and N15-labeled recombinant protein (NP_000506) |
CNY 19,520.00 |
|
TP315644 | Recombinant protein of human growth hormone 1 (GH1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Growth Hormone产品