Acetylcholinesterase (ACHE) (NM_015831) Human Recombinant Protein
CAT#: TP311249
Recombinant protein of human acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E5, 20 µg
View other "Acetylcholinesterase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211249 representing NM_015831
Red=Cloning site Green=Tags(s) MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAE PPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPT SPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLA LQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRAT QLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL DPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQAC AFWNRFLPKLLSATASEAPSTCPGFTHGEAAPRPGLPLPLLLLHQLLLLFLSHLRRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056646 |
Locus ID | 43 |
UniProt ID | P22303 |
Refseq Size | 2978 |
Cytogenetics | 7q22.1 |
Refseq ORF | 1851 |
Synonyms | ACEE; ARACHE; N-ACHE; YT |
Summary | Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. Acetylcholinesterase exists in multiple molecular forms which possess similar catalytic properties, but differ in their oligomeric assembly and mode of cell attachment to the cell surface. It is encoded by the single ACHE gene, and the structural diversity in the gene products arises from alternative mRNA splicing, and post-translational associations of catalytic and structural subunits. The major form of acetylcholinesterase found in brain, muscle and other tissues is the hydrophilic species, which forms disulfide-linked oligomers with collagenous, or lipid-containing structural subunits. The other, alternatively spliced form, expressed primarily in the erythroid tissues, differs at the C-terminal end, and contains a cleavable hydrophobic peptide with a GPI-anchor site. It associates with the membranes through the phosphoinositide (PI) moieties added post-translationally. AChE activity may constitute a sensitive biomarker of RBC ageing in vivo, and thus, may be of aid in understanding the effects of transfusion[provided by RefSeq, Sep 2019] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerophospholipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414362 | ACHE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424577 | ACHE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425009 | ACHE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414362 | Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E5 |
CNY 3,080.00 |
|
LY424577 | Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E6 |
CNY 3,080.00 |
|
LY425009 | Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E6 |
CNY 3,080.00 |
|
PH311249 | ACHE MS Standard C13 and N15-labeled recombinant protein (NP_056646) |
CNY 19,520.00 |
其它Acetylcholinesterase产品