TAPA1 (CD81) (NM_004356) Human Recombinant Protein
CAT#: TP317508
Recombinant protein of human CD81 molecule (CD81), 20 µg
View other "TAPA1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 15 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217508 representing NM_004356
Red=Cloning site Green=Tags(s) MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGA VMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDA NNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAI VVAVIMIFEMILSMVLCCGIRNSSVY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.6 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA standard (PMID: 27408937) ELISA standard (PMID: 27511944) ELISA standard (PMID: 27601437) ELISA standard (PMID: 28105773) |
Reference Data | |
RefSeq | NP_004347 |
Locus ID | 975 |
UniProt ID | P60033, A0A024RCB7 |
Refseq Size | 1497 |
Cytogenetics | 11p15.5 |
Refseq ORF | 708 |
Synonyms | CVID6; S5.7; TAPA1; TSPAN28 |
Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | B cell receptor signaling pathway |
Citations (15)
The use of this Proteins has been cited in the following citations: |
---|
Improved isolation of extracellular vesicles by removal of both free proteins and lipoproteins
,null,
eLife
,PubMed ID 37252755
[CD81]
|
L1CAM is not associated with extracellular vesicles in human cerebrospinal fluid or plasma
,null,
Nature methods
,PubMed ID 34092791
[CD81]
|
Framework for rapid comparison of extracellular vesicle isolation methods
,null,
eLife
,PubMed ID 34783650
[CD81]
|
Plasma Levels of Neuron- and Astrocyte-Derived Exosomal Amyloid Beta1-42, Amyloid Beta1-40, and Phosphorylated Tau Levels in Schizophrenia Patients and Non-psychiatric Comparison Subjects: Relationships With Cognitive Functioning and Psychopathology
,null,
Frontiers in Psychiatry
,PubMed ID 33762974
[CD81]
|
Assessing Neuronal and Astrocyte Derived Exosomes From Individuals With Mild Traumatic Brain Injury for Markers of Neurodegeneration and Cytotoxic Activity
,null,
Frontiers in Neuroscience
,PubMed ID 31680797
[CD81]
|
Growth Hormone-Releasing Hormone Administration in Mild Cognitive Impairment and Its Impact on Neuronal Exosome Biomarkers of Dementia
,Winston, CN;Goetzl, EJ;Baker, LD;Vitiello, MV;Rissman, RA;,
J. Alzheimers Dis.
,PubMed ID 30372675
[CD81]
|
Exosomal biomarkers of brain insulin resistance associated with regional atrophy in Alzheimer's disease
,Mullins, RJ;Mustapic, M;Goetzl, EJ;Kapogiannis, D;,
Hum Brain Mapp
,PubMed ID 28105773
[CD81]
|
Decreased synaptic proteins in neuronal exosomes of frontotemporal dementia and Alzheimer's disease
,Goetzl, EJ;Kapogiannis, D;Schwartz, JB;Lobach, IV;Goetzl, L;Abner, EL;Jicha, GA;Karydas, AM;Boxer, A;Miller, BL;,
FASEB J.2016
,PubMed ID 27601437
[CD81]
|
Cargo proteins of plasma astrocyte-derived exosomes in Alzheimer's disease
,Goetzl, EJ;Mustapic, M;Kapogiannis, D;Eitan, E;Lobach, IV;Goetzl, L;Schwartz, JB;Miller, BL;,
FASEB J.
,PubMed ID 27511944
[CD81]
|
Prediction of conversion from mild cognitive impairment to dementia with neuronally derived blood exosome protein profile
,Winston, CN;Goetzl, EJ;Akers, JC;Carter, BS;Rissmana, R;,
Alzheimer's & Dementia: Diagnosis, Assessment & Disease Monitoring
,PubMed ID 27408937
[CD81]
|
Altered lysosomal proteins in neural-derived plasma exosomes in preclinical Alzheimer disease
,null,
Neurology
,PubMed ID 26062630
[CD81]
|
Aging enhances release of exosomal cytokine mRNAs by Aβ1-42-stimulated macrophages
,null,
The FASEB Journal
,PubMed ID 24014820
[CD81]
|
Dysfunctionally phosphorylated type 1 insulin receptor substrate in neural-derived blood exosomes of preclinical Alzheimer's disease
,Kapogiannis, D;Boxer, A;Schwartz, JB;Abner, EL;Biragyn, A;Masharani, U;Frassetto, L;Petersen, RC;Miller, BL;Goetzl, EJ;,
FASEB J.
,PubMed ID 25342129
[CD81]
|
Identification of preclinical Alzheimer's disease by a profile of pathogenic proteins in neurally derived blood exosomes: A case-control study
,Fiandaca, MS;Kapogiannis, D;Mapstone, M;Boxer, A;Eitan, E;Schwartz, JB;Abner, EL;Petersen, RC;Federoff, HJ;Miller, BL;Goetzl, EJ;,
Alzheimers Dement
,PubMed ID 25130657
[CD81]
|
Isolation of Human Monoclonal Antibodies to the Envelope E2 Protein of Hepatitis C Virus and Their Characterization
,null,
PLoS ONE
,PubMed ID 23409074
[CD81]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |