Xrcc2 (NM_020570) Mouse Recombinant Protein
CAT#: TP523996
Purified recombinant protein of Mouse X-ray repair complementing defective repair in Chinese hamster cells 2 (Xrcc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR223996 representing NM_020570
Red=Cloning site Green=Tags(s) MCSDFRRAESGTELLARLEGRSSLKELEPNLFADEDSPVHGDIFEFHGPEGTGKTEMLYHLTARCILPKS EGGLQIEVLFIDTDYHFDMLRLVTVLEHRLSQSSEEAMKLCLARLFLAYCSSSMQLLLTLHSLEALLCSR PSLCLLIVDSLSSFYWIDRVSGGESVALQESTLQKCSQLLERLVTEYRLLLFATTQSLMQKGSDSADGPS SSKHPCDGDMGYRAYLCKAWQRVVKHRVIFSRDDEAKSSRFSLVSRHLKSNSLKKHSFMVRESGVEFC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 31.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065595 |
Locus ID | 57434 |
UniProt ID | Q9CX47 |
Refseq Size | 3230 |
Cytogenetics | 5 B1 |
Refseq ORF | 834 |
Synonyms | 4921524O04Rik; 8030409M04Rik; RAD51; RecA |
Summary | Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the Rad21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |