DIRAS1 (NM_145173) Human Recombinant Protein
CAT#: TP306160
Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1), 20 µg
View other "DIRAS1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206160 protein sequence
Red=Cloning site Green=Tags(s) MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPA MQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQ EWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660156 |
Locus ID | 148252 |
UniProt ID | O95057 |
Refseq Size | 3412 |
Cytogenetics | 19p13.3 |
Refseq ORF | 594 |
Synonyms | Di-Ras1; GBTS1; RIG |
Summary | DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408035 | DIRAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408035 | Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 1 (DIRAS1) |
CNY 3080.00 |
|
PH306160 | DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156) |
CNY 19520.00 |