KCTD11 Rabbit Polyclonal Antibody
CAT#: TA341730
Rabbit Polyclonal Anti-KCTD11 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,381.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCTD11 antibody: synthetic peptide directed towards the N terminal of human KCTD11. Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | potassium channel tetramerization domain containing 11 |
Database Link | |
Background | The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation ofThe tumor-promoting Hedgehog pathway in medulloblastoma. |
Synonyms | C17orf36; KCASH1; KCTD11; REN |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 90% |
Reference Data | |
Protein Families | Ion Channels: Other |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |