BCL2 (NM_000633) Human Tagged ORF Clone
CAT#: RC204498
BCL2 (Myc-DDK-tagged)-Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha
ORF Plasmid: tGFP
"NM_000633" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 6 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Bcl-2; PPP1R50 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204498 representing NM_000633
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGCACGCTGGGAGAACGGGGTACGATAACCGGGAGATAGTGATGAAGTACATCCATTATAAGCTGT CGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGGCGCCGCGCCCCCGGGGGCCGCCCCCGCACCGGG CATCTTCTCCTCCCAGCCCGGGCACACGCCCCATCCAGCCGCATCCCGGGACCCGGTCGCCAGGACCTCG CCGCTGCAGACCCCGGCTGCCCCCGGCGCCGCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCC ACCTGACCCTCCGCCAGGCCGGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTCCAG CCAGCTGCACCTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGAGCTCTTCAGGGAC GGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGTCATGTGTGTGGAGAGCGTCAACC GGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTGGATGACTGAGTACCTGAACCGGCACCTGCACAC CTGGATCCAGGATAACGGAGGCTGGGATGCCTTTGTGGAACTGTACGGCCCCAGCATGCGGCCTCTGTTT GATTTCTCCTGGCTGTCTCTGAAGACTCTGCTCAGTTTGGCCCTGGTGGGAGCTTGCATCACCCTGGGTG CCTATCTGGGCCACAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204498 representing NM_000633
Red=Cloning site Green=Tags(s) MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF DFSWLSLKTLLSLALVGACITLGAYLGHK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000633 |
ORF Size | 717 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000633.3 |
RefSeq Size | 6492 bp |
RefSeq ORF | 720 bp |
Locus ID | 596 |
UniProt ID | P10415 |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Focal adhesion, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer |
MW | 26.1 kDa |
Gene Summary | This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Citations (6)
The use of this cDNA Clones has been cited in the following citations: |
---|
Extra-mitochondrial prosurvival BCL-2 proteins regulate gene transcription by inhibiting the SUFU tumour suppressor
,Wu, X;Zhang, LS;Toombs, J;Kuo, YC;Piazza, JT;Tuladhar, R;Barrett, Q;Fan, CW;Zhang, X;Walensky, LD;Kool, M;Cheng, SY;Brekken, R;Opferman, JT;Green, DR;Moldoveanu, T;Lum, L;,
Nat. Cell Biol.
,PubMed ID 28945232
[BCL2]
|
microRNA-143 acts as a suppressor of hemangioma growth by targeting Bcl-2
,Huang, C;Huang, J;Ma, P;Yu, G;,
Gene
,PubMed ID 28716710
[BCL2]
|
Lemur tyrosine kinase 2 (LMTK2) is a determinant of cell sensitivity to apoptosis by regulating the levels of the BCL2 family members
,Conti, A;Majorini, MT;Fontanella, E;Bardelli, A;Giacca, M;Delia, D;Mano, M;Lecis, D;,
Cancer Lett
,PubMed ID 28040547
[BCL2]
|
Survivin inhibitor YM155 induces mitochondrial dysfunction, autophagy, DNA damage and apoptosis in BclxL silenced glioma cell lines
,Jane, EP;Premkumar, DR;Sutera, PA;Cavaleri, JM;Pollack, IF;,
Molecular carcinogenesis
,PubMed ID 27805285
[BCL2]
|
The RNA-binding protein LARP1 is a post-transcriptional regulator of survival and tumorigenesis in ovarian cancer
,Hopkins, TG;Mura, M;Al-Ashtal, HA;Lahr, RM;Abd-Latip, N;Sweeney, K;Lu, H;Weir, J;El-Bahrawy, M;Steel, JH;Ghaem-Maghami, S;Aboagye, EO;Berman, AJ;Blagden, SP;,
Nucleic Acids Res.
,PubMed ID 26717985
[BCL2]
|
Waltonitone induces apoptosis through mir-663-induced Bcl-2 downregulation in non-small cell lung cancer
,Zhang, Y;Zhou, X;Xu, X;Zhang, M;Wang, X;Bai, X;Li, H;Kan, L;Zhou, Y;Niu, H;He, P;,
Tumour Biol.
,PubMed ID 25301444
[BCL2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204498L1 | Lenti ORF clone of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC204498L2 | Lenti ORF clone of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, mGFP tagged |
CNY 6,000.00 |
|
RC204498L3 | Lenti ORF clone of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC204498L4 | Lenti ORF clone of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, mGFP tagged |
CNY 6,000.00 |
|
RG204498 | BCL2 (tGFP-tagged) - Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha |
CNY 5,200.00 |
|
SC125546 | BCL2 (untagged)-Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha |
CNY 3,600.00 |