H3.3A (H3F3A) (NM_002107) Human Tagged ORF Clone
CAT#: RC209908
- TrueORF®
H3F3A (Myc-DDK-tagged)-Human H3 histone, family 3A (H3F3A)
ORF Plasmid: tGFP
"NM_002107" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | H3-3B; H3.3A; H3F3; H3F3A |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209908 representing NM_002107.
Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGGCTCGTACAAAGCAGACTGCCCGCAAATCGACCGGTGGTAAAGCACCCAGGAAGCAACTGGCTACA AAAGCCGCTCGCAAGAGTGCGCCCTCTACTGGAGGGGTGAAGAAACCTCATCGTTACAGGCCTGGTACT GTGGCGCTCCGTGAAATTAGACGTTATCAGAAGTCCACTGAACTTCTGATTCGCAAACTTCCCTTCCAG CGTCTGGTGCGAGAAATTGCTCAGGACTTTAAAACAGATCTGCGCTTCCAGAGCGCAGCTATCGGTGCT TTGCAGGAGGCAAGTGAGGCCTATCTGGTTGGCCTTTTTGAAGACACCAACCTGTGTGCTATCCATGCC AAACGTGTAACAATTATGCCAAAAGACATCCAGCTAGCACGCCGCATACGTGGAGAACGTGCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC >Peptide sequence encoded by RC209908
Blue=ORF Red=Cloning site Green=Tag(s) MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQ RLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002107 |
ORF Size | 408 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002107.7 |
RefSeq Size | 2263 bp |
RefSeq ORF | 411 bp |
Locus ID | 3020 |
UniProt ID | P84243 |
Domains | H3, histone |
Protein Pathways | Systemic lupus erythematosus |
MW | 15.3 kDa |
Gene Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded is a replication-independent member of the histone H3 family. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
PRMT6-mediated H3R2me2a guides Aurora B to chromosome arms for proper chromosome segregation
,Kim, S;Kim, NH;Park, JE;Hwang, JW;Myung, N;Hwang, KT;Kim, YA;Jang, CY;Kim, YK;,
Nat Commun
,PubMed ID 32001712
[H3-3A]
|
Histone H3.3K27M Mobilizes Multiple Cancer/Testis (CT) Antigens in Pediatric Glioma
,Deng, H;Zeng, J;Zhang, T;Gong, L;Zhang, H;Cheung, E;Jones, C;Li, G;,
Mol. Cancer Res.
,PubMed ID 29453317
[H3-3A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209908L1 | Lenti ORF clone of Human H3 histone, family 3A (H3F3A), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC209908L2 | Lenti ORF clone of Human H3 histone, family 3A (H3F3A), mGFP tagged |
CNY 4,200.00 |
|
RC209908L3 | Lenti ORF clone of Human H3 histone, family 3A (H3F3A), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC209908L4 | Lenti ORF clone of Human H3 histone, family 3A (H3F3A), mGFP tagged |
CNY 4,200.00 |
|
RG209908 | H3F3A (tGFP-tagged) - Human H3 histone, family 3A (H3F3A) |
CNY 3,400.00 |
|
SC118836 | H3F3A (untagged)-Human H3 histone, family 3A (H3F3A) |
CNY 1,800.00 |