United States
Germany
Japan
United Kingdom
China
Syntaxin 16 (STX16) (NM_003763) Human Mass Spec Standard
CAT＃: PH304347
STX16 MS Standard C13 and N15-labeled recombinant protein (NP_003754)
View other "Syntaxin 16" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | STX16 MS Standard C13 and N15-labeled recombinant protein (NP_003754) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204347 |
| Predicted MW | 34.8 kDa |
| Protein Sequence |
>RC204347 protein sequence
Red=Cloning site Green=Tags(s) MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGR IKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNV VASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTL MVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRK MLVILILFVIIIVLIVVLVGVKSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003754 |
| RefSeq Size | 4915 |
| RefSeq ORF | 912 |
| Synonyms | SYN16 |
| Locus ID | 8675 |
| Cytogenetics | 20q13.32 |
| Summary | This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418449 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424352 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425029 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427489 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418449 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 2 |
CNY 3,080.00 |
|
| LY424352 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 1 |
CNY 3,080.00 |
|
| LY425029 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 1 |
CNY 3,080.00 |
|
| LY427489 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 4 |
CNY 3,080.00 |
|
| TP304347 | Recombinant protein of human syntaxin 16 (STX16), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Syntaxin 16产品
