SCAND1 (NM_016558) Human Mass Spec Standard
CAT#: PH304370
SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_057642)
View other "SCAND1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_057642) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204370 |
Predicted MW | 19.1 kDa |
Protein Sequence |
>RC204370 protein sequence
Red=Cloning site Green=Tags(s) MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057642 |
RefSeq Size | 1388 |
RefSeq ORF | 537 |
Synonyms | RAZ1; SDP1 |
Locus ID | 51282 |
Cytogenetics | 20q11.23 |
Summary | This gene encodes a SCAN box domain-containing protein. The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. This protein binds to and may regulate the function of the transcription factor myeloid zinc finger 1B. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409491 | SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413912 | SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409491 | Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 2 |
CNY 3,080.00 |
|
LY413912 | Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 1 |
CNY 3,080.00 |
|
PH300079 | SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_361012) |
CNY 19,520.00 |
|
TP300079 | Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP304370 | Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 1, 20 µg |
CNY 2,900.00 |