CCL14 (NM_032963) Human Mass Spec Standard
CAT#: PH308370
CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_116739)
View other "CCL14" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_116739) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208370 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC208370 protein sequence
Red=Cloning site Green=Tags(s) MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR GHSVCTNPSDKWVQDYIKDMKEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116739 |
RefSeq Size | 506 |
RefSeq ORF | 279 |
Synonyms | CC-1; CC-3; CKB1; HCC-1; HCC-1(1-74); HCC-1/HCC-3; HCC-3; MCIF; NCC-2; NCC2; SCYA14; SCYL2; SY14 |
Locus ID | 6358 |
Cytogenetics | 17q12 |
Summary | This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409847 | CCL14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418173 | CCL14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409847 | Transient overexpression lysate of chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3 |
CNY 3,080.00 |
|
LY418173 | Transient overexpression lysate of chemokine (C-C motif) ligand 14 (CCL14), transcript variant 1 |
CNY 3,080.00 |
|
PH317672 | CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_004157) |
CNY 19,520.00 |
|
TP308370 | Recombinant protein of human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP317672 | Recombinant protein of human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720662 | Purified recombinant protein of Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3 |
CNY 4,550.00 |