Growth Arrest Specific Protein 7 (GAS7) (NM_003644) Human Mass Spec Standard
CAT#: PH315256
GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635)
View other "Growth Arrest Specific Protein 7" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215256 |
Predicted MW | 39 kDa |
Protein Sequence |
>RC215256 representing NM_003644
Red=Cloning site Green=Tags(s) MSNMENSFDDVSCLSPQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003635 |
RefSeq Size | 7773 |
RefSeq ORF | 1008 |
Locus ID | 8522 |
Cytogenetics | 17p13.1 |
Summary | Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404414 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404415 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418527 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404414 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant b |
CNY 3,080.00 |
|
LY404415 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant c |
CNY 4,840.00 |
|
LY418527 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant a |
CNY 3,080.00 |
|
PH300285 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836) |
CNY 19,520.00 |
|
TP300285 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant b, 20 µg |
CNY 2,900.00 |
|
TP315256 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant a, 20 µg |
CNY 2,900.00 |
|
TP720200 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant d |
CNY 5,460.00 |
其它Growth Arrest Specific Protein 7产品