Growth Arrest Specific Protein 7 (GAS7) (NM_003644) Human Recombinant Protein
CAT#: TP315256
Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant a, 20 µg
View other "Growth Arrest Specific Protein 7" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215256 representing NM_003644
Red=Cloning site Green=Tags(s) MSNMENSFDDVSCLSPQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003635 |
Locus ID | 8522 |
UniProt ID | O60861 |
Refseq Size | 7773 |
Cytogenetics | 17p13.1 |
Refseq ORF | 1008 |
Summary | Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404414 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404415 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418527 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404414 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant b |
CNY 3,080.00 |
|
LY404415 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant c |
CNY 4,840.00 |
|
LY418527 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant a |
CNY 3,080.00 |
|
PH300285 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836) |
CNY 19,520.00 |
|
PH315256 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635) |
CNY 19,520.00 |
|
TP300285 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant b, 20 µg |
CNY 2,900.00 |
|
TP720200 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant d |
CNY 5,460.00 |
其它Growth Arrest Specific Protein 7产品