Grancalcin (GCA) (NM_012198) Human Recombinant Protein
CAT#: TP302677
Recombinant protein of human grancalcin, EF-hand calcium binding protein (GCA), 20 µg
View other "Grancalcin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202677 protein sequence
Red=Cloning site Green=Tags(s) MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF LQGTMAI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036330 |
Locus ID | 25801 |
UniProt ID | P28676 |
Refseq Size | 3241 |
Cytogenetics | 2q24.2 |
Refseq ORF | 651 |
Synonyms | GCL |
Summary | This gene encodes a calcium-binding protein that is abundant in neutrophils and macrophages. In the absence of divalent cation, this protein localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the presence of magnesium and calcium, it associates with both the granule and membrane fractions. Alternative splicing and use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Aug 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415909 | GCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415909 | Transient overexpression lysate of grancalcin, EF-hand calcium binding protein (GCA) |
CNY 3,080.00 |
|
PH302677 | GCA MS Standard C13 and N15-labeled recombinant protein (NP_036330) |
CNY 19,520.00 |
|
TP720123 | Recombinant protein of human grancalcin, EF-hand calcium binding protein (GCA) |
CNY 4,550.00 |
其它Grancalcin产品