DNAAF9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C20ORF194 antibody: synthetic peptide directed towards the C terminal of human C20ORF194. Synthetic peptide located within the following region: FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	chromosome 20 open reading frame 194
Database Link	NP_001009984 Entrez Gene 25943 Human UniProt ID Q5TEA3
Background	The function of the C20orf194 gene has not yet been determined.
Synonyms	DKFZp434N061; MGC117480; MGC141683
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Yeast: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.