Skor1 Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Lbxcor1 antibody: synthetic peptide directed towards the middle region of mouse Lbxcor1. Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	100 kDa
Gene Name	SKI family transcriptional corepressor 1
Database Link	NP_766034 Entrez Gene 207667 Mouse UniProt ID Q8BX46
Background	Lbxcor1 inhibits BMP signaling. Lbxcor1 acts as a transcriptional corepressor of LBX1.
Synonyms	AV273001; C230094B15Rik; Corl1; Lbxcor1
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Human: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.