Zhx3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Zhx3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLEA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	104 kDa
Gene Name	zinc fingers and homeoboxes 3
Database Link	NP_796237 Entrez Gene 320799 Mouse UniProt ID Q8C0Q2
Background	Zhx3 acts as a transcriptional repressor. Is a regulator of podocyte gene expression during primary glomerula disease.
Synonyms	KIAA0395; OTTHUMP00000031006; TIX1
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 86%; Pig: 83%; Yeast: 83%; Guinea pig: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.